PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.234310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 363aa    MW: 41594.9 Da    PI: 8.5365
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.234310.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.8e-17120167148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde+l+ +++ +G g+W++ ++  g+ R++k+c++rw +yl
   Cucsa.234310.1 120 KGAWTKEEDERLISYIRAHGEGCWRSLPKAAGLLRCGKSCRLRWINYL 167
                      79******************************99************97 PP

2Myb_DNA-binding59.47.8e-19173217147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T+eEdel+++++ +lG++ W++Ia +++ gRt++++k++w+++
   Cucsa.234310.1 173 RGNFTEEEDELIIKLHSLLGNK-WSLIAGRLP-GRTDNEIKNYWNTH 217
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-24111170IPR009057Homeodomain-like
PROSITE profilePS5129416.879115167IPR017930Myb domain
SMARTSM007171.4E-13119169IPR001005SANT/Myb domain
SuperFamilySSF466891.69E-29119214IPR009057Homeodomain-like
PfamPF002492.6E-15120167IPR001005SANT/Myb domain
CDDcd001672.08E-10122167No hitNo description
PROSITE profilePS5129429.411168222IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-28171222IPR009057Homeodomain-like
SMARTSM007176.3E-18172220IPR001005SANT/Myb domain
PfamPF002495.2E-17173217IPR001005SANT/Myb domain
CDDcd001677.32E-13175218No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010224Biological Processresponse to UV-B
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1903086Biological Processnegative regulation of sinapate ester biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MIKEKEKEKE RERERRAGAG ILLSNLSHQL ASRSNYPSPH FSSLFFFISQ NAIKLLTNPF  60
QWPPLLFPKP PFSSTLLHFK PFFHLGFPLI FLGFPCFFLF FCLFCEMGRS PCCEKAHTNK  120
GAWTKEEDER LISYIRAHGE GCWRSLPKAA GLLRCGKSCR LRWINYLRPD LKRGNFTEEE  180
DELIIKLHSL LGNKWSLIAG RLPGRTDNEI KNYWNTHIRR KLLNRGIDPV THRPINETSQ  240
EQVASTTISF TATDVKVKVE EDKSMVVEEF QDLEREDFPI EERCPDLNLE LRISPPYQSH  300
PEKIVGPKNL CFACSLGLQN SKDCSCKIGC SIGTSTGNNN KVGYDFLGIK NGILDYRSLE  360
MK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-301202227108B-MYB
1h8a_C1e-2911922226128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00479DAPTransfer from AT4G38620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819130.0LN681913.1 Cucumis melo genomic scaffold, anchoredscaffold00045.
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004147038.10.0PREDICTED: myb-related protein 308-like
SwissprotP813931e-118MYB08_ANTMA; Myb-related protein 308
TrEMBLA0A0A0LLM61e-164A0A0A0LLM6_CUCSA; Uncharacterized protein
STRINGPOPTR_0004s18020.11e-130(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26434221
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.11e-115myb domain protein 4